PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 208aa    MW: 21986.3 Da    PI: 6.358
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15019.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.22.1e-5724119297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+++re+egek
  PK15019.1  24 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQRFREMEGEK 119
                89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-5419127IPR009072Histone-fold
SuperFamilySSF471133.57E-4026123IPR009072Histone-fold
PfamPF008081.3E-272993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-205775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-207694No hitNo description
PRINTSPR006151.1E-2095113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MADSDNDSGG HNAGANANSE LSPREQDRLL PIANVSRIMK KALPANAKIS KDAKETVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGFEE YVEPLKIYLQ RFREMEGEKG  120
GGVAAAREKD AVSGSVGNGG GGGYGDGMYG SGMVMMGQQQ QQQQHQGHVY GSGGFHQMAG  180
NSSGGGGGLG PKSGPDHLSP TSNYGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B9e-4821114194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4821114194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.14e-95PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0S3S6N15e-94A0A0S3S6N1_PHAAN; Uncharacterized protein
TrEMBLA0A0L9VBC05e-94A0A0L9VBC0_PHAAN; Uncharacterized protein
STRINGVIT_19s0015g00440.t013e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-74nuclear factor Y, subunit B3